[4]EBI [5]Databases [6]Protein Databases [7]SAS
[8]About [9]Contact us
[10][IMG]
FASTA alignment for PDB entry 1tsr(B) - coloured by no. of contacts to ligand
Below are the FASTA results from a search of the sequence of PDB entry 1tsr(B) against all [11][IMG]
protein sequences in the PDB. Identical sequences are grouped together and represented by Struct
a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. [12][IMG]
The number of sequences represented by each consensus sequence is shown by the '×n' on the FASTA
right of the alignment. Use the box below to modify the annotations shown on the
alignment. At the bottom of the page are given the FASTA stats for all the sequences.
There you can exclude any sequences from the alignment.
The search returned 100 unique sequences (including 12 consensus sequences) giving 115 sequence
matches in all. The 95 sequences excluded from the alignment are listed at the end.
Modify alignment: Annotate by: [[13]________________________________] [14][ APPLY ]
Number: [[15]________________________]
Show secondary structure: Yes [16]( ) No [17]( )
1 2 3 4 5 6
12345678901234567890123456789012345678901234567890123456789012345 Protein name
---------+---------+---------+---------+---------+---------+----- ------------
[18]1tsr:A ------sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp P53 core domain in complex with DNA
[19]1tup:A ------sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Tumor suppressor p53 complexed with DNA
[20]2ac0:A ------sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Structural basis of DNA recognition by p53 tetramers ...
[21]2h1l:M ---splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp The structure of the oncoprotein sv40 large t antigen and ...
[22]2xwr:A ---wplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Crystal structure of the DNA-binding domain of human p53 ...
[23]3kmd:A ----plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Crystal structure of the p53 core domain bound to a full ...
[24]2fej:A ------sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Solution structure of human p53 DNA binding domain.
[25]1gzh:C -------ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Crystal structure of the brct domains of human 53bp1 bound ...
[26]1kzy:A -------ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Crystal structure of the 53bp1 brct region complexed to ...
[27]2ady:A -------ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Structural basis of DNA recognition by p53 tetramers ...
[28]2ahi:A -------ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Structural basis of DNA recognition by p53 tetramers ...
[29]2pcx:A hhhhhhsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Crystal structure of p53dbd(r282q) at 1.54-angstrom ...
[30]2ocj:A --------svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain in the absence of DNA
[31]2ata:A --------svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Structural basis of DNA recognition by p53 tetramers ...
[32]2qxa:A --------svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain mutant v157f
[33]2qxb:A --------svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain mutant n235k
[34]2qxc:A --------svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain mutant n239y
[35]2qvq:A ------sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain mutant v157f/n235k/n239y
[36]1ycs:A ---------vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp P53-53bp2 complex
[37]3d0a:A --------svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain with hot spot mutation r249s and ...
[38]3d07:A ------sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpp Human p53 core domain with hot spot mutation r249s (iii)
1 1 1 1
7 8 9 0 1 2 3
67890123456789012345678901234567890123456789012345678901234567890 Protein name
----+---------+---------+---------+---------+---------+---------+ ------------
[39]1tsr:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv P53 core domain in complex with DNA
[40]1tup:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Tumor suppressor p53 complexed with DNA
[41]2ac0:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Structural basis of DNA recognition by p53 tetramers ...
[42]2h1l:M pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv The structure of the oncoprotein sv40 large t antigen and ...
[43]2xwr:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Crystal structure of the DNA-binding domain of human p53 ...
[44]3kmd:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Crystal structure of the p53 core domain bound to a full ...
[45]2fej:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Solution structure of human p53 DNA binding domain.
[46]1gzh:C pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Crystal structure of the brct domains of human 53bp1 bound ...
[47]1kzy:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Crystal structure of the 53bp1 brct region complexed to ...
[48]2ady:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Structural basis of DNA recognition by p53 tetramers ...
[49]2ahi:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Structural basis of DNA recognition by p53 tetramers ...
[50]2pcx:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Crystal structure of p53dbd(r282q) at 1.54-angstrom ...
[51]2ocj:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain in the absence of DNA
[52]2ata:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Structural basis of DNA recognition by p53 tetramers ...
[53]2qxa:A pgtrframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain mutant v157f
[54]2qxb:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain mutant n235k
[55]2qxc:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain mutant n239y
[56]2qvq:A pgtrframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain mutant v157f/n235k/n239y
[57]1ycs:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv P53-53bp2 complex
[58]3d0a:A pgtrvramaiykqsqrmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain with hot spot mutation r249s and ...
[59]3d07:A pgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsvv Human p53 core domain with hot spot mutation r249s (iii)
1 1 1 1 1 1
4 5 6 7 8 9
12345678901234567890123456789012345678901234567890123456789012345 Protein name
---------+---------+---------+---------+---------+---------+----- ------------
[60]1tsr:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr P53 core domain in complex with DNA
[61]1tup:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Tumor suppressor p53 complexed with DNA
[62]2ac0:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Structural basis of DNA recognition by p53 tetramers ...
[63]2h1l:M vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr The structure of the oncoprotein sv40 large t antigen and ...
[64]2xwr:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Crystal structure of the DNA-binding domain of human p53 ...
[65]3kmd:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Crystal structure of the p53 core domain bound to a full ...
[66]2fej:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Solution structure of human p53 DNA binding domain.
[67]1gzh:C vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Crystal structure of the brct domains of human 53bp1 bound ...
[68]1kzy:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Crystal structure of the 53bp1 brct region complexed to ...
[69]2ady:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Structural basis of DNA recognition by p53 tetramers ...
[70]2ahi:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Structural basis of DNA recognition by p53 tetramers ...
[71]2pcx:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdq Crystal structure of p53dbd(r282q) at 1.54-angstrom ...
[72]2ocj:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain in the absence of DNA
[73]2ata:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Structural basis of DNA recognition by p53 tetramers ...
[74]2qxa:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain mutant v157f
[75]2qxb:A vpyeppevgsdcttihykymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain mutant n235k
[76]2qxc:A vpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain mutant n239y
[77]2qvq:A vpyeppevgsdcttihykymcysscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain mutant v157f/n235k/n239y
[78]1ycs:A vpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdr P53-53bp2 complex
[79]3d0a:A vpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain with hot spot mutation r249s and ...
[80]3d07:A vpyeppevgsdcttihynymcnsscmggm-rspiltiitledssgnllgrnsfevrvcacpgrdr Human p53 core domain with hot spot mutation r249s (iii)
2 2
0 1
678901234567890 Protein name
----+---------+ ------------
[81]1tsr:A rteeenl-------- P53 core domain in complex with DNA
[82]1tup:A rteeenl-------- Tumor suppressor p53 complexed with DNA
[83]2ac0:A rteeenlrkk----- Structural basis of DNA recognition by p53 tetramers ...
[84]2h1l:M rteeenl-------- The structure of the oncoprotein sv40 large t antigen and ...
[85]2xwr:A rteeenl-------- Crystal structure of the DNA-binding domain of human p53 ...
[86]3kmd:A rteeenlrk------ Crystal structure of the p53 core domain bound to a full ...
[87]2fej:A rteeenlrkkgephh Solution structure of human p53 DNA binding domain.
[88]1gzh:C rteeenlr------- Crystal structure of the brct domains of human 53bp1 bound ...
[89]1kzy:A rteeenl-------- Crystal structure of the 53bp1 brct region complexed to ...
[90]2ady:A rteeenlrkk----- Structural basis of DNA recognition by p53 tetramers ...
[91]2ahi:A rteeenlrkkg---- Structural basis of DNA recognition by p53 tetramers ...
[92]2pcx:A rteeenlrkk----- Crystal structure of p53dbd(r282q) at 1.54-angstrom ...
[93]2ocj:A rteeenl-------- Human p53 core domain in the absence of DNA
[94]2ata:A rteeenlrkk----- Structural basis of DNA recognition by p53 tetramers ...
[95]2qxa:A rteeenl-------- Human p53 core domain mutant v157f
[96]2qxb:A rteeenl-------- Human p53 core domain mutant n235k
[97]2qxc:A rteeenl-------- Human p53 core domain mutant n239y
[98]2qvq:A rteeenl-------- Human p53 core domain mutant v157f/n235k/n239y
[99]1ycs:A rteee---------- P53-53bp2 complex
[100]3d0a:A rteeenlrk------ Human p53 core domain with hot spot mutation r249s and ...
[101]3d07:A rteeen--------- Human p53 core domain with hot spot mutation r249s (iii)
Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.
Sequence listing
The listing below shows the FASTA statistics for the PDB entries that matched PDB entry 1tsr(B).
Ditto marks indicate identical sequences represented by a single representative sequence in the
alignment above. The representative is asterisked and the names of all its duplicate sequences are
indented to the right.
Structures whose names are given in purple are those that are annotated above. Note that annotations
are only transferred to the submitted sequence from sequences that have at least a 30% sequence
identity and and overlap of at least 80 residues (or 3/4 of the length of the submitted sequence, if
this is shorter), or E-value < 0.001.
Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to
add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page
to redisplay the alignment.
Aligned sequences
Smith-
Waterman %-tage a.a. Seq E- PDB
score identity overlap len z-score value code Protein name
1. - - - 196 - - [102]1tsr:A P53 core domain in complex with DNA
2. 1371 100.0% 196 196 1855.8 1.8e-96 [103][ ] [104]1tup:A Tumor suppressor p53 complexed with DNA
3. 1371 100.0% 196 199 1855.7 1.9e-96 [105][ ] [106]2ac0:A Structural basis of DNA recognition by p53 tetramers
(complex i)
4. 1371 100.0% 196 199 1855.7 1.9e-96 [107][ ] [108]2h1l:M The structure of the oncoprotein sv40 large t antigen and
p53 tumor suppressor complex
5. 1371 100.0% 196 199 1855.7 1.9e-96 [109][ ] [110]2xwr:A Crystal structure of the DNA-binding domain of human p53
wit extended n terminus
6. 1371 100.0% 196 200 1855.7 1.9e-96 [111][ ] [112]3kmd:A Crystal structure of the p53 core domain bound to a full
con site as a self-assembled tetramer
7. 1371 100.0% 196 204 1855.6 1.9e-96 [113][ ] [114]2fej:A Solution structure of human p53 DNA binding domain.
8. 1366 100.0% 195 196 1849.1 4.4e-96 [115][ ] [116]1gzh:C Crystal structure of the brct domains of human 53bp1
bound to the p53 tumor supressor
9. 1366 100.0% 195 195 1849.1 4.4e-96 [117][ ] [118]1kzy:A Crystal structure of the 53bp1 brct region complexed to
tumor suppressor p53
10. 1366 100.0% 195 198 1849.0 4.4e-96 [119][ ] [120]2ady:A Structural basis of DNA recognition by p53 tetramers
(complex iv)
11. 1366 100.0% 195 199 1849.0 4.4e-96 [121][ ] [122]2ahi:A Structural basis of DNA recognition by p53 tetramers
(complex iii)
12. 1365 99.5% 196 205 1847.4 5.4e-96 [123][ ] [124]2pcx:A Crystal structure of p53dbd(r282q) at 1.54-angstrom
resolution
13. 1361 100.0% 194 194 1842.4 1e-95 [125][ ] [126]2ocj:A Human p53 core domain in the absence of DNA
14. 1361 100.0% 194 197 1842.3 1e-95 [127][ ] [128]2ata:A Structural basis of DNA recognition by p53 tetramers
(complex ii)
15. 1355 99.5% 194 194 1834.3 2.9e-95 [129][ ] [130]2qxa:A Human p53 core domain mutant v157f
16. 1354 99.5% 194 194 1832.9 3.5e-95 [131][ ] [132]2qxb:A Human p53 core domain mutant n235k
17. 1352 99.5% 194 194 1830.2 4.9e-95 [133][ ] [134]2qxc:A Human p53 core domain mutant n239y
18. 1349 98.5% 196 196 1826.1 8.3e-95 [135][ ] [136]2qvq:A Human p53 core domain mutant v157f/n235k/n239y
19. 1344 100.0% 191 191 1819.5 1.9e-94 [137][ ] [138]1ycs:A P53-53bp2 complex
20. 1343 99.0% 194 196 1818.0 2.4e-94 [139][ ] [140]3d0a:A Human p53 core domain with hot spot mutation r249s and
second site suppressor mutation h168r in
sequence-specific complex with DNA
21. 1339 99.0% 195 194 1812.6 4.7e-94 [141][ ] [142]3d07:A Human p53 core domain with hot spot mutation r249s (iii)
Number of sequences: 21
Excluded sequences
Smith-
Waterman %-tage a.a. Seq E- PDB
score identity overlap len z-score value code Protein name
1. 1338 97.9% 194 195 1811.3 5.6e-94 [143][ ] [144]1uol:A Crystal structure of the human p53 core domain
mutant m133l/v203a/n239y/n268d at 1.9 a resolution.
2. 1334 98.5% 196 197 1805.8 1.1e-93 [145][ ] [146]3igl:A Diversity in DNA recognition by p53 revealed by
crystal stru with hoogsteen base pairs (p53-DNA
complex 1)
3. 1333 97.4% 194 195 1804.5 1.3e-93 [147][ ] [148]2j1w:A Human p53 core domain mutant
m133l-v143a-v203a-n239y-n268d
4. 1331 97.4% 194 195 1801.8 1.9e-93 [149][ ] [150]2bim:A Human p53 core domain mutant
m133l-v203a-n239y-n268d-r273h
5. 1331 97.4% 194 195 1801.8 1.9e-93 [151][ ] [152]2j1z:A Human p53 core domain mutant
m133l-v203a-n239y-n268d-f270l
6. 1329 99.0% 193 191 1799.2 2.6e-93 [153][ ] [154]2ybg:A Structure of lys120-acetylated p53 core domain
7. 1329 98.5% 195 195 1799.1 2.7e-93 [155][ ] [156]3kz8:A Diversity in DNA recognition by p53 revealed by
[2]spacer [3]spacer crystal stru with hoogsteen base pairs (p53-DNA
complex 3)
8. 1328 96.9% 194 196 1797.7 3.2e-93 [157][ ] [158]2wgx:A Human p53 core domain mutant
m133l-v203a-y236f-n239y-t253i- n268d
9. 1327 97.4% 194 195 1796.4 3.8e-93 [159][ ] [160]2j1x:A Human p53 core domain mutant
m133l-v203a-y220c-n239y-n268d
10. 1327 97.4% 194 195 1796.4 3.8e-93 [161][ ] [162]2j20:A Human p53 core domain mutant
m133l-v203a-n239y-n268d-r273c
11. 1327 97.4% 194 195 1796.4 3.8e-93 [163][ ] [164]2vuk:A ^* Structure of the p53 core domain mutant y220c bound
to the stabilizing small-molecule drug phikan083
12. " " " " " " = [165]2x0u:A ^* Structure of the p53 core domain mutant y220c
bound to a 2- amino substituted benzothiazole
scaffold
13. " " " " " " = [166]2x0w:A ^* Structure of the p53 core domain mutant y220c
bound to 5,6- dimethoxy-2-methylbenzothiazole
14. " " " " " " = [167]4agl:A ^* Structure of the p53 core domain mutant y220c
bound to the stabilizing small molecule phikan784
15. 1327 97.4% 194 196 1796.4 3.8e-93 [168][ ] [169]4ago:A ^* Structure of the p53 core domain mutant y220c bound
to the stabilizing small molecule phikan5174
16. " " " " " " = [170]4agp:A ^* Structure of the p53 core domain mutant y220c
bound to the stabilizing small molecule phikan5176
17. 1327 97.4% 194 195 1796.4 3.8e-93 [171][ ] [172]4agq:A Structure of the p53 core domain mutant y220c bound
to the stabilizing small molecule phikan5196
18. 1327 97.4% 194 197 1796.3 3.8e-93 [173][ ] [174]4agm:A ^* Structure of the p53 core domain mutant y220c bound
to the stabilizing small molecule phikan5086
19. " " " " " " = [175]4agn:A ^* Structure of the p53 core domain mutant y220c
bound to the stabilizing small molecule phikan5116
20. 1316 97.4% 196 197 1781.5 2.5e-92 [176][ ] [177]3igk:A Diversity in DNA recognition by p53 revealed by
crystal stru with hoogsteen base pairs (p53-DNA
complex 2)
21. 1297 96.4% 194 193 1755.9 6.7e-91 [178][ ] [179]2x0v:A Structure of the p53 core domain mutant y220c bound
to 4-( trifluoromethyl)benzene-1,2-diamine
22. 1293 95.9% 195 192 1750.6 1.3e-90 [180][ ] [181]2j1y:A Human p53 core domain mutant
m133l-v203a-n239y-g245s-n268d
23. 1274 94.8% 193 188 1725.0 3.5e-89 [182][ ] [183]2j21:A Human p53 core domain mutant
m133l-v203a-n239y-n268d-r282w
24. 1262 94.8% 194 188 1708.8 2.8e-88 [184][ ] [185]3d09:A Human p53 core domain with hot spot mutation r249s
and second-site suppressor mutations h168r and
t123a
25. 1252 93.4% 196 233 1694.0 1.9e-87 [186][ ] [187]3q01:A An induced fit mechanism regulates p53 DNA binding
kinetics sequence specificity
26. 1252 93.4% 196 234 1694.0 1.9e-87 [188][ ] [189]3q05:A ^* An induced fit mechanism regulates p53 DNA binding
kinetics sequence specificity
27. " " " " " " = [190]3ts8:A ^* Crystal structure of a multidomain human p53
tetramer bound natural cdkn1a(p21) p53-response
element
28. 1242 93.3% 194 231 1680.6 1.1e-86 [191][ ] [192]3q06:A An induced fit mechanism regulates p53 DNA binding
kinetics sequence specificity
29. 1234 93.3% 193 186 1671.1 3.6e-86 [193][ ] [194]2bio:A Human p53 core domain mutant
m133l-v203a-n239y-r249s-n268d
30. 1214 88.2% 195 196 1643.7 1.2e-84 [195][ ] [196]2p52:A Mouse p53 DNA-binding domain in zinc-free oxidized
state
31. 1203 91.8% 194 185 1629.2 7.7e-84 [197][ ] [198]2bip:A Human p53 core domain mutant
m133l-h168r-v203a-n239y-r249s- n268d
32. 1198 91.2% 194 185 1622.5 1.8e-83 [199][ ] [200]2biq:A Human p53 core domain mutant
t123a-m133l-h168r-v203a-n239y- r249s-n268d
33. 1192 88.4% 190 194 1614.1 5.4e-83 [201][ ] [202]3exl:A Crystal structure of a p53 core tetramer bound to
DNA
34. 1185 88.4% 189 194 1604.6 1.8e-82 [203][ ] [204]3exj:A Crystal structure of a p53 core tetramer bound to
DNA
35. 1178 88.8% 187 187 1595.4 5.9e-82 [205][ ] [206]2ioi:A ^* Crystal structure of the mouse p53 core domain at
1.55 a
36. " " " " " " = [207]2iom:A ^* Mouse p53 core domain soaked with 2-propanol
37. " " " " " " = [208]2ioo:A ^* Crystal structure of the mouse p53 core domain
38. 1170 88.7% 186 186 1584.6 2.4e-81 [209][ ] [210]1hu8:A Crystal structure of the mouse p53 core DNA-binding
domain at 2.7a resolution
39. 1144 85.8% 190 188 1549.4 2.1e-79 [211][ ] [212]2geq:A Crystal structure of a p53 core dimer bound to DNA
40. 1238 94.3% 193 183 1536.1 1.2e-78 [213][ ] [214]3d05:A Human p53 core domain with hot spot mutation r249s
(ii)
41. 1233 94.2% 191 182 1533.4 1.7e-78 [215][ ] [216]3d08:A Human p53 core domain with hot spot mutation r249s
and second-site suppressor mutation h168r
42. 1206 92.7% 192 179 1499.7 1.3e-76 [217][ ] [218]3d06:A Human p53 core domain with hot spot mutation r249s
(i)
43. 1195 91.7% 193 183 1469.9 5.8e-75 [219][ ] [220]2bin:A Human p53 core domain mutant
m133l-h168r-v203a-n239y-n268d
44. 1242 94.4% 195 187 1130.7 4.5e-56 [221][ ] [222]1gzh:A Crystal structure of the brct domains of human
53bp1 bound to the p53 tumor supressor
45. 816 59.8% 194 198 1106.0 1.1e-54 [223][ ] [224]4g83:A Crystal structure of p73 DNA-binding domain
tetramer bound t response-element
46. 816 59.8% 194 202 1105.9 1.1e-54 [225][ ] [226]3vd0:A ^* Structure of p73 DNA binding domain tetramer
modulates p73 transactivation
47. " " " " " " = [227]3vd1:A ^* Structure of p73 DNA binding domain tetramer
modulates p73 transactivation
48. 816 59.8% 194 203 1105.9 1.1e-54 [228][ ] [229]3vd2:A Structure of p73 DNA binding domain tetramer
modulates p73 transactivation
49. 816 59.8% 194 201 1105.9 1.1e-54 [230][ ] [231]4g82:A Crystal structure of p73 DNA-binding domain
tetramer bound t response-element
50. 816 59.8% 194 205 1105.8 1.1e-54 [232][ ] [233]4a63:A Crystal structure of the p73-aspp2 complex at 2.6a
resolution
51. 805 55.6% 198 233 1090.2 8.1e-54 [234][ ] [235]2rmn:A The solution structure of the p63 DNA-binding
domain
52. 796 56.2% 194 195 1079.1 3.4e-53 [236][ ] [237]3qyn:A ^* Structure of p63 DNA binding domain in complex with
a 22 bas rich response element containing 2 base
pair spacer between sites
53. " " " " " " = [238]3us0:A ^* Structure of p63 DNA binding domain in complex
with a 22 bas rich response element containing a
two base pair "at" space half sites
54. 778 58.2% 194 204 1054.5 7.9e-52 [239][ ] [240]2xip:A ^* Crystal structure of the DNA binding domain of
human tp73 refined at 1.8 a resolution
55. " " " " " " = [241]2xwc:A ^* Crystal structure of the DNA binding domain of
human tp73 refined at 1.8 a resolution
56. 777 56.0% 193 193 1053.5 9e-52 [242][ ] [243]3us1:A ^* Structure of p63 DNA binding domain in complex with
a 22 bas response element containing a two base
pair "gc" spacer bet sites
57. " " " " " " = [244]3us2:A ^* Structure of p63 DNA binding domain in complex
with a 19 bas rich response element containing two
half sites with a sing pair overlap
58. 774 55.7% 194 192 1049.5 1.5e-51 [245][ ] [246]3qym:A Structure of p63 DNA binding domain in complex with
a 10 bas rich response element half site
59. 731 56.5% 177 182 991.7 2.5e-48 [247][ ] [248]3us1:D ^* Structure of p63 DNA binding domain in complex with
a 22 bas response element containing a two base
pair "gc" spacer bet sites
60. " " " " " " = [249]3us2:B ^* Structure of p63 DNA binding domain in complex
with a 19 bas rich response element containing two
half sites with a sing pair overlap
61. 91 33.3% 48 196 126.7 3.8 [250][ ] [251]1t4w:A Structural differences in the DNA binding domains
of human p53 and its c. Elegans ortholog cep-1:
structure of c. Elegans cep-1
62. 91 27.8% 115 287 124.5 5 [252][ ] [253]2xyq:A Crystal structure of the nsp16 nsp10 sars
coronavirus comple
63. 91 27.8% 115 286 124.5 5 [254][ ] [255]2xyr:A Crystal structure of the nsp16 nsp10 sars
coronavirus comple
64. 91 27.8% 115 285 124.5 5 [256][ ] [257]2xyv:A Crystal structure of the nsp16 nsp10 sars
coronavirus comple
65. 91 27.8% 115 292 124.4 5.1 [258][ ] [259]3r24:A Crystal structure of nsp10/nsp16 complex of sars
coronavirus possible
66. 86 31.2% 80 117 123.1 6 [260][ ] [261]1d4v:A Crystal structure of trail-dr5 complex
67. 91 36.1% 61 941 117.4 13 [262][ ] [263]3spa:A Crystal structure of human mitochondrial RNA
polymerase
68. 81 28.6% 56 129 115.7 15 [264][ ] [265]1o4x:A Ternary complex of the DNA binding domains of the
oct1 and sox2 transcription factors with a 19mer
oligonucleotide from the hoxb1 regulatory element
69. 81 29.3% 75 149 114.9 17 [266][ ] [267]3f59:A Crystal structure of zu5-ank, the spectrin binding
region of erythroid ankyrin
70. 84 22.2% 144 365 113.6 20 [268][ ] [269]3i26:A ^* Structure of bovine torovirus
hemagglutinin-esterase
71. " " " " " " = [270]3i27:A ^* Structure of bovine torovirus
hemagglutinin-esterase in comp receptor
72. 83 31.1% 45 295 113.5 21 [271][ ] [272]3s5n:A Crystal structure of human 4-hydroxy-2-oxoglutarate
aldolase
73. 83 31.1% 45 295 113.5 21 [273][ ] [274]3s5o:A Crystal structure of human 4-hydroxy-2-oxoglutarate
aldolase pyruvate
74. 83 21.3% 155 312 113.2 21 [275][ ] [276]3h5c:B X-ray structure of protein z-protein z inhibitor
complex
75. 83 28.6% 77 348 112.5 23 [277][ ] [278]3mav:A Crystal structure of plasmodium vivax putative
farnesyl pyro synthase (pv092040)
76. 83 28.6% 77 357 112.4 24 [279][ ] [280]2ihi:D Crystal structure of plasmodium vivax putative
farnesyl pyrophosphate synthase (pv092040)
77. 74 35.7% 42 70 109.9 32 [281][ ] [282]2gvm:A Crystal structure of hydrophobin hfbi with
detergent
78. 74 35.7% 42 72 109.8 33 [283][ ] [284]2fz6:A Crystal structure of hydrophobin hfbi
79. 77 27.6% 76 149 109.5 34 [285][ ] [286]3f59:B Crystal structure of zu5-ank, the spectrin binding
region of erythroid ankyrin
80. 77 21.6% 74 164 108.9 37 [287][ ] [288]3mln:E DNA binding domain of early b-cell factor 1 (ebf1)
bound to (crystal form ii)
81. 80 25.3% 75 347 108.5 39 [289][ ] [290]3mys:A Crystal structure of plasmodium vivax putative
polyprenyl pyrophosphate synthase in complex with
geranylgeranyl dipho
82. 80 25.3% 75 347 108.5 39 [291][ ] [292]3ph7:A Crystal structure of plasmodium vivax putative
polyprenyl pyrophosphate synthase in complex with
geranylgeranyl dipho
83. 77 34.3% 35 177 108.4 39 [293][ ] [294]2jlm:A Structure of a putative acetyltransferase
(aciad1637) from acinetobacter baylyi adp1
84. 80 25.3% 75 358 108.3 40 [295][ ] [296]3cc9:B Crystal structure of plasmodium vivax putative
polyprenyl pyrophosphate synthase in complex with
geranylgeranyl diphosphate
85. 80 28.6% 77 358 108.3 40 [297][ ] [298]3ez3:A ^* Crystal structure of plasmodium vivax
geranylgeranylpyrophos synthase pvx_092040 with
zoledronate and ipp bound
86. " " " " " " = [299]3ldw:A ^* Crystal structure of plasmodium vivax
geranylgeranylpyrophos synthase pvx_092040 with
zoledronate and ipp bound
87. 80 28.6% 77 355 108.3 40 [300][ ] [301]3rbm:A Crystal structure of plasmodium vivax
geranylgeranylpyrophos synthase complexed with bph
-703
88. 80 28.6% 77 358 108.3 40 [302][ ] [303]3ryw:A Crystal structure of p. Vivax geranylgeranyl
diphosphate syn complexed with bph-811
89. 80 25.3% 75 360 108.2 40 [304][ ] [305]3mys:B Crystal structure of plasmodium vivax putative
polyprenyl pyrophosphate synthase in complex with
geranylgeranyl dipho
90. 79 33.9% 56 288 108.2 40 [306][ ] [307]3sqq:A Cdk2 in complex with inhibitor rc-3-96
91. 76 28.8% 73 153 108.0 42 [308][ ] [309]3f59:C Crystal structure of zu5-ank, the spectrin binding
region of erythroid ankyrin
92. 76 28.8% 73 153 108.0 42 [310][ ] [311]3kbu:C Crystal structure of the ankyrin binding domain of
human ery beta spectrin (repeats 13-15) in complex
with the spectrin domain of human erythroid ankyrin
(zu5-ank), emts derivativ
93. 76 28.8% 73 157 107.8 43 [312][ ] [313]3kbt:C Crystal structure of the ankyrin binding domain of
human ery beta spectrin (repeats 13-15) in complex
with the spectrin domain of human erythroid ankyrin
(zu5-ank)
94. 76 28.8% 73 156 107.8 42 [314][ ] [315]3kbu:D Crystal structure of the ankyrin binding domain of
human ery beta spectrin (repeats 13-15) in complex
with the spectrin domain of human erythroid ankyrin
(zu5-ank), emts derivativ
95. 79 26.7% 60 328 107.5 45 [316][ ] [317]2yv3:A Crystal structure of aspartate semialdehyde
dehydrogenase fr thermophilus hb8
Number of sequences: 95
Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : [318][ ] select all/none [319][ ] invert selection
Then click [320][ SELECT ] to effect selection changes.
References
Visible links
1. http://www.ebi.ac.uk/inc/head.html
4. http://www.ebi.ac.uk/
5. http://www.ebi.ac.uk/Databases/
6. http://www.ebi.ac.uk/Databases/protein.html
7. http://www.ebi.ac.uk/thornton-srv/databases/sas
8. http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetPage.pl?doc=TRUE&pdbcode=n/a&SAS=TRUE&template=about.html
9. http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetPage.pl?doc=TRUE&pdbcode=n/a&SAS=TRUE&template=contactus.html
10. http://www.ebi.ac.uk/thornton-srv/databases/sas
11. http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetPage.pl?pdbcode=&template=struct.html&SAS=TRUE&u=1115693¶m1=4
12. http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/sas/GetSAStext.pl?file=fasta.out&type=text&user_id=1115693
18. http://www.ebi.ac.uk/pdbsum/1tsr
19. http://www.ebi.ac.uk/pdbsum/1tup
20. http://www.ebi.ac.uk/pdbsum/2ac0
21. http://www.ebi.ac.uk/pdbsum/2h1l
22. http://www.ebi.ac.uk/pdbsum/2xwr
23. http://www.ebi.ac.uk/pdbsum/3kmd
24. http://www.ebi.ac.uk/pdbsum/2fej
25. http://www.ebi.ac.uk/pdbsum/1gzh
26. http://www.ebi.ac.uk/pdbsum/1kzy
27. http://www.ebi.ac.uk/pdbsum/2ady
28. http://www.ebi.ac.uk/pdbsum/2ahi
29. http://www.ebi.ac.uk/pdbsum/2pcx
30. http://www.ebi.ac.uk/pdbsum/2ocj
31. http://www.ebi.ac.uk/pdbsum/2ata
32. http://www.ebi.ac.uk/pdbsum/2qxa
33. http://www.ebi.ac.uk/pdbsum/2qxb
34. http://www.ebi.ac.uk/pdbsum/2qxc
35. http://www.ebi.ac.uk/pdbsum/2qvq
36. http://www.ebi.ac.uk/pdbsum/1ycs
37. http://www.ebi.ac.uk/pdbsum/3d0a
38. http://www.ebi.ac.uk/pdbsum/3d07
39. http://www.ebi.ac.uk/pdbsum/1tsr
40. http://www.ebi.ac.uk/pdbsum/1tup
41. http://www.ebi.ac.uk/pdbsum/2ac0
42. http://www.ebi.ac.uk/pdbsum/2h1l
43. http://www.ebi.ac.uk/pdbsum/2xwr
44. http://www.ebi.ac.uk/pdbsum/3kmd
45. http://www.ebi.ac.uk/pdbsum/2fej
46. http://www.ebi.ac.uk/pdbsum/1gzh
47. http://www.ebi.ac.uk/pdbsum/1kzy
48. http://www.ebi.ac.uk/pdbsum/2ady
49. http://www.ebi.ac.uk/pdbsum/2ahi
50. http://www.ebi.ac.uk/pdbsum/2pcx
51. http://www.ebi.ac.uk/pdbsum/2ocj
52. http://www.ebi.ac.uk/pdbsum/2ata
53. http://www.ebi.ac.uk/pdbsum/2qxa
54. http://www.ebi.ac.uk/pdbsum/2qxb
55. http://www.ebi.ac.uk/pdbsum/2qxc
56. http://www.ebi.ac.uk/pdbsum/2qvq
57. http://www.ebi.ac.uk/pdbsum/1ycs
58. http://www.ebi.ac.uk/pdbsum/3d0a
59. http://www.ebi.ac.uk/pdbsum/3d07
60. http://www.ebi.ac.uk/pdbsum/1tsr
61. http://www.ebi.ac.uk/pdbsum/1tup
62. http://www.ebi.ac.uk/pdbsum/2ac0
63. http://www.ebi.ac.uk/pdbsum/2h1l
64. http://www.ebi.ac.uk/pdbsum/2xwr
65. http://www.ebi.ac.uk/pdbsum/3kmd
66. http://www.ebi.ac.uk/pdbsum/2fej
67. http://www.ebi.ac.uk/pdbsum/1gzh
68. http://www.ebi.ac.uk/pdbsum/1kzy
69. http://www.ebi.ac.uk/pdbsum/2ady
70. http://www.ebi.ac.uk/pdbsum/2ahi
71. http://www.ebi.ac.uk/pdbsum/2pcx
72. http://www.ebi.ac.uk/pdbsum/2ocj
73. http://www.ebi.ac.uk/pdbsum/2ata
74. http://www.ebi.ac.uk/pdbsum/2qxa
75. http://www.ebi.ac.uk/pdbsum/2qxb
76. http://www.ebi.ac.uk/pdbsum/2qxc
77. http://www.ebi.ac.uk/pdbsum/2qvq
78. http://www.ebi.ac.uk/pdbsum/1ycs
79. http://www.ebi.ac.uk/pdbsum/3d0a
80. http://www.ebi.ac.uk/pdbsum/3d07
81. http://www.ebi.ac.uk/pdbsum/1tsr
82. http://www.ebi.ac.uk/pdbsum/1tup
83. http://www.ebi.ac.uk/pdbsum/2ac0
84. http://www.ebi.ac.uk/pdbsum/2h1l
85. http://www.ebi.ac.uk/pdbsum/2xwr
86. http://www.ebi.ac.uk/pdbsum/3kmd
87. http://www.ebi.ac.uk/pdbsum/2fej
88. http://www.ebi.ac.uk/pdbsum/1gzh
89. http://www.ebi.ac.uk/pdbsum/1kzy
90. http://www.ebi.ac.uk/pdbsum/2ady
91. http://www.ebi.ac.uk/pdbsum/2ahi
92. http://www.ebi.ac.uk/pdbsum/2pcx
93. http://www.ebi.ac.uk/pdbsum/2ocj
94. http://www.ebi.ac.uk/pdbsum/2ata
95. http://www.ebi.ac.uk/pdbsum/2qxa
96. http://www.ebi.ac.uk/pdbsum/2qxb
97. http://www.ebi.ac.uk/pdbsum/2qxc
98. http://www.ebi.ac.uk/pdbsum/2qvq
99. http://www.ebi.ac.uk/pdbsum/1ycs
100. http://www.ebi.ac.uk/pdbsum/3d0a
101. http://www.ebi.ac.uk/pdbsum/3d07
102. http://www.ebi.ac.uk/pdbsum/1tsr
104. http://www.ebi.ac.uk/pdbsum/1tup
106. http://www.ebi.ac.uk/pdbsum/2ac0
108. http://www.ebi.ac.uk/pdbsum/2h1l
110. http://www.ebi.ac.uk/pdbsum/2xwr
112. http://www.ebi.ac.uk/pdbsum/3kmd
114. http://www.ebi.ac.uk/pdbsum/2fej
116. http://www.ebi.ac.uk/pdbsum/1gzh
118. http://www.ebi.ac.uk/pdbsum/1kzy
120. http://www.ebi.ac.uk/pdbsum/2ady
122. http://www.ebi.ac.uk/pdbsum/2ahi
124. http://www.ebi.ac.uk/pdbsum/2pcx
126. http://www.ebi.ac.uk/pdbsum/2ocj
128. http://www.ebi.ac.uk/pdbsum/2ata
130. http://www.ebi.ac.uk/pdbsum/2qxa
132. http://www.ebi.ac.uk/pdbsum/2qxb
134. http://www.ebi.ac.uk/pdbsum/2qxc
136. http://www.ebi.ac.uk/pdbsum/2qvq
138. http://www.ebi.ac.uk/pdbsum/1ycs
140. http://www.ebi.ac.uk/pdbsum/3d0a
142. http://www.ebi.ac.uk/pdbsum/3d07
144. http://www.ebi.ac.uk/pdbsum/1uol
146. http://www.ebi.ac.uk/pdbsum/3igl
148. http://www.ebi.ac.uk/pdbsum/2j1w
150. http://www.ebi.ac.uk/pdbsum/2bim
152. http://www.ebi.ac.uk/pdbsum/2j1z
154. http://www.ebi.ac.uk/pdbsum/2ybg
156. http://www.ebi.ac.uk/pdbsum/3kz8
158. http://www.ebi.ac.uk/pdbsum/2wgx
160. http://www.ebi.ac.uk/pdbsum/2j1x
162. http://www.ebi.ac.uk/pdbsum/2j20
164. http://www.ebi.ac.uk/pdbsum/2vuk
165. http://www.ebi.ac.uk/pdbsum/2x0u
166. http://www.ebi.ac.uk/pdbsum/2x0w
167. http://www.ebi.ac.uk/pdbsum/4agl
169. http://www.ebi.ac.uk/pdbsum/4ago
170. http://www.ebi.ac.uk/pdbsum/4agp
172. http://www.ebi.ac.uk/pdbsum/4agq
174. http://www.ebi.ac.uk/pdbsum/4agm
175. http://www.ebi.ac.uk/pdbsum/4agn
177. http://www.ebi.ac.uk/pdbsum/3igk
179. http://www.ebi.ac.uk/pdbsum/2x0v
181. http://www.ebi.ac.uk/pdbsum/2j1y
183. http://www.ebi.ac.uk/pdbsum/2j21
185. http://www.ebi.ac.uk/pdbsum/3d09
187. http://www.ebi.ac.uk/pdbsum/3q01
189. http://www.ebi.ac.uk/pdbsum/3q05
190. http://www.ebi.ac.uk/pdbsum/3ts8
192. http://www.ebi.ac.uk/pdbsum/3q06
194. http://www.ebi.ac.uk/pdbsum/2bio
196. http://www.ebi.ac.uk/pdbsum/2p52
198. http://www.ebi.ac.uk/pdbsum/2bip
200. http://www.ebi.ac.uk/pdbsum/2biq
202. http://www.ebi.ac.uk/pdbsum/3exl
204. http://www.ebi.ac.uk/pdbsum/3exj
206. http://www.ebi.ac.uk/pdbsum/2ioi
207. http://www.ebi.ac.uk/pdbsum/2iom
208. http://www.ebi.ac.uk/pdbsum/2ioo
210. http://www.ebi.ac.uk/pdbsum/1hu8
212. http://www.ebi.ac.uk/pdbsum/2geq
214. http://www.ebi.ac.uk/pdbsum/3d05
216. http://www.ebi.ac.uk/pdbsum/3d08
218. http://www.ebi.ac.uk/pdbsum/3d06
220. http://www.ebi.ac.uk/pdbsum/2bin
222. http://www.ebi.ac.uk/pdbsum/1gzh
224. http://www.ebi.ac.uk/pdbsum/4g83
226. http://www.ebi.ac.uk/pdbsum/3vd0
227. http://www.ebi.ac.uk/pdbsum/3vd1
229. http://www.ebi.ac.uk/pdbsum/3vd2
231. http://www.ebi.ac.uk/pdbsum/4g82
233. http://www.ebi.ac.uk/pdbsum/4a63
235. http://www.ebi.ac.uk/pdbsum/2rmn
237. http://www.ebi.ac.uk/pdbsum/3qyn
238. http://www.ebi.ac.uk/pdbsum/3us0
240. http://www.ebi.ac.uk/pdbsum/2xip
241. http://www.ebi.ac.uk/pdbsum/2xwc
243. http://www.ebi.ac.uk/pdbsum/3us1
244. http://www.ebi.ac.uk/pdbsum/3us2
246. http://www.ebi.ac.uk/pdbsum/3qym
248. http://www.ebi.ac.uk/pdbsum/3us1
249. http://www.ebi.ac.uk/pdbsum/3us2
251. http://www.ebi.ac.uk/pdbsum/1t4w
253. http://www.ebi.ac.uk/pdbsum/2xyq
255. http://www.ebi.ac.uk/pdbsum/2xyr
257. http://www.ebi.ac.uk/pdbsum/2xyv
259. http://www.ebi.ac.uk/pdbsum/3r24
261. http://www.ebi.ac.uk/pdbsum/1d4v
263. http://www.ebi.ac.uk/pdbsum/3spa
265. http://www.ebi.ac.uk/pdbsum/1o4x
267. http://www.ebi.ac.uk/pdbsum/3f59
269. http://www.ebi.ac.uk/pdbsum/3i26
270. http://www.ebi.ac.uk/pdbsum/3i27
272. http://www.ebi.ac.uk/pdbsum/3s5n
274. http://www.ebi.ac.uk/pdbsum/3s5o
276. http://www.ebi.ac.uk/pdbsum/3h5c
278. http://www.ebi.ac.uk/pdbsum/3mav
280. http://www.ebi.ac.uk/pdbsum/2ihi
282. http://www.ebi.ac.uk/pdbsum/2gvm
284. http://www.ebi.ac.uk/pdbsum/2fz6
286. http://www.ebi.ac.uk/pdbsum/3f59
288. http://www.ebi.ac.uk/pdbsum/3mln
290. http://www.ebi.ac.uk/pdbsum/3mys
292. http://www.ebi.ac.uk/pdbsum/3ph7
294. http://www.ebi.ac.uk/pdbsum/2jlm
296. http://www.ebi.ac.uk/pdbsum/3cc9
298. http://www.ebi.ac.uk/pdbsum/3ez3
299. http://www.ebi.ac.uk/pdbsum/3ldw
301. http://www.ebi.ac.uk/pdbsum/3rbm
303. http://www.ebi.ac.uk/pdbsum/3ryw
305. http://www.ebi.ac.uk/pdbsum/3mys
307. http://www.ebi.ac.uk/pdbsum/3sqq
309. http://www.ebi.ac.uk/pdbsum/3f59
311. http://www.ebi.ac.uk/pdbsum/3kbu
313. http://www.ebi.ac.uk/pdbsum/3kbt
315. http://www.ebi.ac.uk/pdbsum/3kbu
317. http://www.ebi.ac.uk/pdbsum/2yv3